PRKCG antibody

• Catalog Number: orb583152
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PRKCG
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: ChIP, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PRKCG
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 78kDa
• Target: PRKCG
• UniProt ID: P05129
• Protein Sequence: Synthetic peptide located within the following region: FVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSL
• NCBI: NP_002730
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: PKCC, PKCG, SCA14, PKCI(3), PKCgamma, PKC-gamma
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Mouse, Target Name: PRKCG, Sample Tissue: Mouse Brain, Antibody dilution: 1 ug/ml.

Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.

Rabbit Anti-PRKCG Antibody, Catalog Number: orb583152, Formalin Fixed Paraffin Embedded Tissue: Human Testis Tissue, Observed Staining: Cytoplasm, Plasma membrane, Primary Antibody Concentration: 1:600, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-PRKCG Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Human Placenta.