You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb583733 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to PRKACA |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Sheep, Zebrafish |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human PRKACA |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 40 kDa |
Target | PRKACA |
UniProt ID | D4ACM4 |
Protein Sequence | Synthetic peptide located within the following region: MASNSSDVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRV |
NCBI | NP_997401 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | CAFD1, PKACA, PPNAD4 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The canonical isoform at 40 kDa is shown, and a smaller isoform of ~32 kDa also contains the peptide sequence, as do several other possible isoforms.
Host: Mouse, Target Name: PRKACA, Sample Tissue: Mouse Heart, Antibody dilution: 1 ug/ml.
Host: Rabbit, Target Name: PRKACA, Sample Tissue: Mouse Heart, Antibody dilution: 1 ug/ml.
Rabbit Anti-PRKACA Antibody, Catalog Number: orb583733, Formalin Fixed Paraffin Embedded Tissue: Human Heart Muscle Tissue, Observed Staining: Cytoplasm, Primary Antibody Concentration: 1:600, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
Rabbit Anti-PRKACA Antibody, Catalog Number: orb583733, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic, Primary Antibody Concentration: N/A, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-PRKACA Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Human Placenta.
IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, WB | |
Human, Mouse, Rat | |
Monoclonal | |
Unconjugated |
FC, IF, IHC-P, WB | |
Bovine, Rabbit, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IF, IHC-P, WB | |
Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IF, IHC-P, WB | |
Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating