PRKAA2 antibody

• Catalog Number: orb330884
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PRKAA2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Sheep, Zebrafish
• Reactivity: Human, Mouse, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PRKAA2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 62kDa
• Target: PRKAA2
• UniProt ID: P54646
• Protein Sequence: Synthetic peptide located within the following region: AYHLIIDNRRIMNQASEFYLASSPPSGSFMDDSAMHIPPGLKPHPERMPP
• NCBI: NP_006243
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti AMPK antibody, anti AMPK2 antibody, anti PRKA
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: rat hepatocyte (50 ug), Primary dilution: 1:4000, Secondary Antibody:Donkey anti-Rabbit HRP, Secondary dilution: 1:10000.

Host: Mouse, Target Name: PRKAA2, Sample Tissue: Mouse Skeletal Muscle, Antibody dilution: 1 ug/ml.

Host: Rabbit, Target Name: PRKAA2, Sample Tissue: Mouse Skeletal Muscle, Antibody dilution: 1 ug/ml.

PRKAA2 antibody - middle region (orb330884) validated by WB using Rat Liver, Human Muscle, Rat Muscle, Mouse Muscle at 1:1000.

WB Suggested Anti-PRKAA2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Jurkat cell lysate.