Primate IFN gamma protein

Catalog Number: orb419314

Catalog Number	orb419314
Category	Proteins
Description	Recombinant Rhesus Macaque Interferon gamma active
Tag	Tag-Free
Form/Appearance	Lyophilized powder
Purity	> 97% as determined by SDS-PAGE and HPLC.
MW	16.8 kDa
UniProt ID	P63310
Protein Sequence	QDPYVKEAENLKKYFNAGDPDVADNGTLFLDILRNWKEESDRKIMQSQIVSFYFKLFKNFKDDQRIQKSVETIKEDINVKFFNSNKKKRDDFEKLTNYSVTDSNVQRKAVHELIQVMAELSPAAKIGKRKRSQMFRGRRASQ
Protein Length	Full Length of Mature Protein
Source	E.Coli
Biological Origin	Macaca mulatta (Rhesus macaque)
Biological Activity	Fully biologically active when compared to standard. The ED50 as determined by an anti-viral assay using human HeLa cells infected with encephalomyocarditis (EMC) virus is less than 20.0 ng/ml, corresponding to a specific activity of ＞ 5.0 ×104 IU/mg.
Expression Region	24-165aa
Endotoxins	Less than 1.0 EU/µg as determined by LAL method.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer/Preservatives	Lyophilized from a 0.2 µm filtered PBS, pH 7.4
Alternative names	IFN-gamma, Read more...
Note	For research use only
Application notes	Tag Info: NO-taggedExpression Region: 24-165aaSequence Info: Full Length of Mature Protein
Expiration Date	6 months from date of receipt.

Purity:	> 95% by SDS-PAGE and HPLC analyses.
MW:	Approximately 15.6 kDa, a single non-glycosylated polypeptide chain containing 135 amino acids.
Source:	Escherichia coli.

Purity:	> 95% by SDS-PAGE and HPLC analyses
MW:	Approximately 15.6 kDa, a single non-glycosylated polypeptide chain containing 134 amino acids.
Source:	Escherichia coli.

Purity:	> 98% by SDS-PAGE and HPLC analyses.
MW:	Approximately 17 kDa, a single non-glycosylated polypeptide chain containing 144 amino acids.
Source:	Escherichia coli