You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb585934 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to PRDX4 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human PRDX4 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 31 kDa |
Target | PRDX4 |
UniProt ID | Q13162 |
Protein Sequence | Synthetic peptide located within the following region: LLLFLLPAGAVQGWETEERPRTREEECHFYAGGQVYPGEASRVSVADHSL |
NCBI | NP_006397 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | PRX-4, AOE372, AOE37-2, HEL-S-97n Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 10-20% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.
Host: Rabbit, Target Name: PRDX4, Sample Tissue: Human MCF7 Whole Cell, Antibody dilution: 1 ug/ml.
Host: Rabbit, Target Name: PRDX4, Sample Type: COLO205 Whole cell lysates, Antibody dilution: 1.0 ug/ml. PRDX4 is supported by BioGPS gene expression data to be expressed in COLO205.
FC, ICC, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating