PRDX1 antibody

• Catalog Number: orb330556
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PRDX1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PRDX1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 22kDa
• Target: PRDX1
• UniProt ID: Q06830
• Protein Sequence: Synthetic peptide located within the following region: SSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFV
• NCBI: NP_002565
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti MSP23 antibody, anti NKEFA antibody, anti PAG
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

PRDX1 antibody - N-terminal region (orb330556) validated by WB using 2. mouse brain extracts (80 ug), 3. rat brain extract (80 ug) at 2 ug/ml.

Application: IHC, Species+tissue/cell type: Human brain stem cells, Primary antibody dilution: 1:500, Secondary antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary antibody dilution: 1:1000.

WB Suggested Anti-PRDX1 Antibody, Positive Control: Lane 1: 20 ug human dental pulp stem cell lysate, Primary Antibody Dilution: 1:500, Secondary Antibody: Anti-rabbit-AP, Secondry Antibody Dilution: 1:500.

WB Suggested Anti-PRDX1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: 293T cell lysate.