PRDM9 antibody

• Catalog Number: orb324624
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PRDM9
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Human
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PRDM9
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 103kDa
• Target: PRDM9
• UniProt ID: Q9NQV7
• Protein Sequence: Synthetic peptide located within the following region: CPGDQNQEQQYPDPHSRNDKTKGQEIKERSKLLNKRTWQREISRAFSSPP
• NCBI: NP_064612
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti PFM6 antibody, anti MSBP3 antibody, anti PRMD
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of human HepG2 tissue using PRDM9 antibody

Western blot analysis of 293T cells lysate tissue using PRDM9 antibody

Immunohistochemical staining of human Testis tissue using PRDM9 antibody

Immunohistochemical staining of human Testis tissue using PRDM9 antibody

Immunohistochemical staining of human Placenta tissue using PRDM9 antibody

Western blot analysis of human 293T tissue using PRDM9 antibody

Western blot analysis of human MCF7 tissue using PRDM9 antibody

Anti-PRDM9 antibody IHC staining of human skeletal muscle. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/mL.

Anti-PRDM9 antibody IHC staining of human testis. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/mL.

Host: Rabbit, Target Name: PRDM9, Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 1 ug/mL.

Host: Rabbit, Target Name: PRDM9, Sample Type: 293T, Antibody Dilution: 1.0 ug/mL.

Host: Rabbit, Target Name: PRDM9, Sample Type: HepG2, Antibody Dilution: 1.0 ug/mL.

Host: Rabbit, Target Name: PRDM9, Sample Type: MCF7, Antibody Dilution: 1.0 ug/mL.

Rabbit Anti-PRDM9 Antibody, Paraffin Embedded Tissue: Human Placenta, Antibody Concentration: 5 ug/mL.

WB Suggested Anti-PRDM9 Antibody Titration: 1 ug/mL, Positive Control: 293T cells lysate.