You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb573831 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Prdm4 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat, Yeast |
Reactivity | Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Prdm4 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 88kDa |
Target | Prdm4 |
UniProt ID | Q80V63 |
Protein Sequence | Synthetic peptide located within the following region: HLKTCKEPSSSSSAQEEEDDESEEEDLADSMRTEDCRMGSAVYSTDESLS |
NCBI | NP_857633 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | SC, SC-, SC1, SC-1, AW552272, 1700031E19Rik, 28104 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: Prdm4, Sample Type: Mouse Liver lysates, Antibody dilution: 1.0 ug/ml.
ELISA, ICC, IF, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating