Prdm4 antibody

• Catalog Number: orb573831
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Prdm4
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat, Yeast
• Reactivity: Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Prdm4
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 88kDa
• Target: Prdm4
• UniProt ID: Q80V63
• Protein Sequence: Synthetic peptide located within the following region: HLKTCKEPSSSSSAQEEEDDESEEEDLADSMRTEDCRMGSAVYSTDESLS
• NCBI: NP_857633
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: SC, SC-, SC1, SC-1, AW552272, 1700031E19Rik, 28104
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: Prdm4, Sample Type: Mouse Liver lysates, Antibody dilution: 1.0 ug/ml.