You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb581355 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to PPP3CA |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Porcine, Rabbit, Rat, Zebrafish |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human PPP3CA |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 59kDa |
Target | PPP3CA |
UniProt ID | P63329 |
Protein Sequence | Synthetic peptide located within the following region: MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHL |
NCBI | NP_000935 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | CALN, CCN1, CNA1, CALNA, DEE91, IECEE, PPP2B, ACCI Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Mouse, Target Name: PPP3CA, Sample Tissue: Mouse Heart, Antibody dilution: 1 ug/ml.
Host: Rabbit, Target Name: PPP3CA, Sample Tissue: Mouse Heart, Antibody dilution: 1 ug/ml.
WB Suggested Anti-PPP3CA Antibody, Positive Control: Lane 1: 80 ug mouse brain extract, Lane 2: 80 ug rat brain extract, Primary Antibody Dilution: 1:500, Secondary Antibody: IRDye 800 CW goat anti-rabbit, Secondry Antibody Dilution: 1:20000.
WB Suggested Anti-PPP3CA Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: 293T cell lysate.
WB | |
Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating