PPP1R3B antibody

• Catalog Number: orb585176
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PPP1R3B
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 31kDa
• Target: PPP1R3B
• UniProt ID: Q86XI6
• Protein Sequence: Synthetic peptide located within the following region: LSSKNEASGMVAPAVQEKKVKKRVSFADNQGLALTMVKVFSEFDDPLDMP
• NCBI: NP_078883
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: GL, PTG, PPP1R4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target: PPP1R3B, Positive control (+): Rat Liver (R-LI), Negative control (-): Mouse Spleen (M-SP), Antibody concentration: 1 ug/ml.

WB Suggested Anti-PPP1R3B Antibody, Titration: 1.0 ug/ml, Positive Control: MCF7 Whole Cell.