PPP1CA antibody

• Catalog Number: orb330990
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PPP1CA
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat
• Reactivity: Canine, Guinea pig, Human, Mouse, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PPP1CA
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 38kDa
• Target: PPP1CA
• UniProt ID: Q07161
• Protein Sequence: Synthetic peptide located within the following region: MSDSEKLNLDSIIGRLLEGSRVLTPHCAPVQGSRPGKNVQLTENEIRGLC
• NCBI: NP_001008709
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti MGC15877 antibody, anti MGC1674 antibody, ant
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of HEK293 lysate tissue using PPP1CA antibody

Western blot analysis of Jurkat cell lysate tissue using PPP1CA antibody

WB Suggested Anti-PPP1CA Antibody, Positive Control: Lane 1: 40 ug HEK293 lysate, Lane 2: 40 ug H1299 lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Goat anti-rabbit-HRP, Secondry Antibody Dilution: 1:5000.

WB Suggested Anti-PPP1CA Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Jurkat cell lysate, PPP1CA is supported by BioGPS gene expression data to be expressed in Jurkat.