PPIA Rabbit Polyclonal Antibody

• Catalog Number: orb581362
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PPIA
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Sheep
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PPIA
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 18kDa
• Target: PPIA
• UniProt ID: P62937
• Protein Sequence: Synthetic peptide located within the following region: TAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE
• NCBI: NP_066953
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CYPA, CYPH, HEL-S-69p
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human HepG2, Antibody dilution: 1.0 ug/ml.

Human Intestine

WB Suggested Anti-PPIA Antibody Titration: 2.5 ug/ml, Positive Control: HepG2 cell lysate. PPIA is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.