PPAT Rabbit Polyclonal Antibody

• Catalog Number: orb579658
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PPAT
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PPAT
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 57 kDa
• Target: PPAT
• UniProt ID: Q06203
• Protein Sequence: Synthetic peptide located within the following region: VTSDGSSVPTFKSHKGMGLVNHVFTEDNLKKLYVSNLGIGHTRYATTGKC
• NCBI: NP_002694
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: GPAT, PRAT, ATASE
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: 1. Human Skin Fibroblasts (100 ug), 2. HepG2 cells (20 ug), 3. HEK273 cells (20 ug), 4. HeLa skin cells(20 ug), 5. Hamster CHO K1 cells (20 ug), Primary dilution: 1:5000, Secondary Antibody: Clean-Blot IP detection Reagent and Kit, Secondary dilution: 1:2000.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

Sample Tissue: Human 293T Whole Cell, Antibody dilution: 1 ug/ml.

Human kidney

PPAT antibody - N-terminal region (orb579658) validated by WB using HepG2 Cell Lysate at 0.25 ug/ml. PPAT is supported by BioGPS gene expression data to be expressed in HepG2.