You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330094 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Ppargc1a |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Human, Rabbit, Rat, Sheep |
Reactivity | Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse Ppargc1a |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 90kDa |
Target | Ppargc1a |
UniProt ID | O70343 |
Protein Sequence | Synthetic peptide located within the following region: QEIRAELNKHFGHPCQAVFDDKSDKTSELRDGDFSNEQFSKLPVFINSGL |
NCBI | NP_032930 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti A830037N07Rik antibody, anti PGC-1 antibody, Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of SP2/0 cell lysate tissue using Ppargc1a antibody
Western blot analysis of SP2/0 tissue using Ppargc1a antibody
Western blot analysis of Transfected Melanoma tissue using Ppargc1a antibody
Ppargc1a antibody - middle region (orb330094) validated by WB using Transfected Melanoma Cell at 1:1000.
WB Suggested Anti-Ppargc1a Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: SP2/0 cell lysate.
ELISA, IF, IHC-P, WB | |
Bovine, Porcine | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, FC, IF, IHC | |
Bovine, Canine, Human, Mouse, Rat | |
Goat | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC-P, WB | |
Bovine, Porcine | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IHC-P, WB | |
Bovine, Canine, Equine, Gallus, Porcine, Rabbit, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating