PPARGC1A Rabbit Polyclonal Antibody

• Catalog Number: orb329608
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PPARGC1A
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: ICC, IF, WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Zebrafish
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PPARGC1A
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 91kDa
• Target: PPARGC1A
• UniProt ID: Q9UBK2
• Protein Sequence: Synthetic peptide located within the following region: PSFDALTDGDVTTDNEASPSSMPDGTPPPQEAEEPSLLKKLLLAPANTQL
• NCBI: NP_037393
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti LEM6 antibody, anti PGC-1(alpha) antibody, an
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human 786-0, Antibody Dilution: 1.0 ug/mL.

Sample Type: Mouse retina, Primary Antibody Dilution: 1:200, Secondary Antibody: Donkey anti rabbit-Cy3, Secondary Antibody Dilution: 1:1000, Color/Signal Descriptions: Red: PPARGC1A, Gene Name: PPARGC1A.

WB Suggested Anti-PPARGC1A Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate.