You have no items in your shopping cart.
Cart summary
POU4F3 polyclonal antibody (A01)
Catalog Number: orb2292369
| Catalog Number | orb2292369 |
|---|---|
| Category | Antibodies |
| Description | Mouse polyclonal antibody raised against a partial recombinant POU4F3. |
| Species/Host | Mouse |
| Clonality | Polyclonal |
| Tested applications | ELISA |
| Reactivity | Human |
| Immunogen | POU4F3 (NP_002691, 100 a.a. ~ 190 a.a) partial recombinant protein with GST tag. |
| Conjugation | Unconjugated |
| Protein Sequence | PAALTSHPHHAVHQGLEGDLLEHISPTLSVSGLGAPEHSVMPAQIHPHHLGAMGHLHQAMGMSHPHTVAPHSAMPACLSDVESDPRELEAF |
| NCBI | NP_002691 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | 50 % glycerol |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
