POU3F1 antibody

• Catalog Number: orb574494
• Category: Antibodies
• Description: Rabbit polyclonal antibody to POU3F1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat
• Reactivity: Bovine, Canine, Guinea pig, Human, Mouse, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human POU3F1
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 45kDa
• Target: POU3F1
• UniProt ID: Q03052
• Protein Sequence: Synthetic peptide located within the following region: YLPRGPGGGAGGTGPLMHPDAAAAAAAAAERLHAGAAYREVQKLMHHEWL
• NCBI: NP_002690
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: OCT6, OTF6, SCIP
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

Human kidney

WB Suggested Anti-POU3F1 Antibody Titration: 2.5 ug/ml, Positive Control: Jurkat cell lysate.