POU2F3 antibody

• Catalog Number: orb329670
• Category: Antibodies
• Description: Rabbit polyclonal antibody to POU2F3
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Canine, Guinea pig, Rabbit, Sheep, Zebrafish
• Reactivity: Human, Mouse, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human POU2F3
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 47kDa
• Target: POU2F3
• UniProt ID: Q9UKI9
• Protein Sequence: Synthetic peptide located within the following region: KMSGDVADSTDARSTLSQVEPGNDRKGLDFNRQIKTEDLSDSLQQTLSHR
• NCBI: NP_055167
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti PLA1 antibody, anti OCT11 antibody, anti PLA-
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rat, Target Name: POU2F3, Sample Tissue: Rat Brain, Antibody Dilution: 1 ug/mL.

Sample Type: Mouse tongue tissue, Primary Antibody Dilution: 1:100, Secondary Antibody: Anti-rabbit-Cy3, Secondary Antibody Dilution: 1:500, Color/Signal Descriptions: Red: POU2F3, Gene Name: POU2F3.

WB Suggested Anti-POU2F3 Antibody, Titration: 1.25 ug/mL, Positive Control: HepG2 Whole Cell.