You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb329670 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to POU2F3 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Canine, Guinea pig, Rabbit, Sheep, Zebrafish |
Reactivity | Human, Mouse, Rat |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human POU2F3 |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 47kDa |
Target | POU2F3 |
UniProt ID | Q9UKI9 |
Protein Sequence | Synthetic peptide located within the following region: KMSGDVADSTDARSTLSQVEPGNDRKGLDFNRQIKTEDLSDSLQQTLSHR |
NCBI | NP_055167 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti PLA1 antibody, anti OCT11 antibody, anti PLA- Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rat, Target Name: POU2F3, Sample Tissue: Rat Brain, Antibody Dilution: 1 ug/mL.
Sample Type: Mouse tongue tissue, Primary Antibody Dilution: 1:100, Secondary Antibody: Anti-rabbit-Cy3, Secondary Antibody Dilution: 1:500, Color/Signal Descriptions: Red: POU2F3, Gene Name: POU2F3.
WB Suggested Anti-POU2F3 Antibody, Titration: 1.25 ug/mL, Positive Control: HepG2 Whole Cell.
IHC, WB | |
Canine, Guinea pig, Rabbit, Sheep, Zebrafish | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Canine, Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating