You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb578117 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to POSTN |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human POSTN |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 93kDa |
Target | POSTN |
UniProt ID | Q15063 |
Protein Sequence | Synthetic peptide located within the following region: VTKFIEGGDGHLFEDEEIKRLLQGDTPVRKLQANKKVQGSRRRLREGRSQ |
NCBI | NP_006466 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | PN, OSF2, OSF-2, PDLPOSTN Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Anti-POSTN / Periostin antibody IHC staining of human heart. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
Anti-POSTN / Periostin antibody IHC staining of human uterus. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
Host: Rabbit, Target Name: POSTN, Sample Tissue: Human A549 Whole Cell, Antibody Dilution: 1 ug/ml.
Host: Rabbit, Target Name: POSTN, Sample Tissue: Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.
Rabbit Anti-POSTN Antibody, Paraffin Embedded Tissue: Human Uterus, Antibody Concentration: 5 ug/ml.
WB Suggested Anti-POSTN Antibody, Titration: 1 ug/ml, Positive Control: 293T cells lysate.
ELISA, IHC, WB | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC, WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating