You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb580851 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to PORCN |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human PORCN |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 52 kDa |
Target | PORCN |
UniProt ID | Q9H237 |
Protein Sequence | Synthetic peptide located within the following region: ACRLLWRLGLPSYLKHASTVAGGFFSLYHFFQLHMVWVVLLSLLCYLVLF |
NCBI | NP_073736 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | PPN, DHOF, FODH, MG61, PORC Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.
Host: Rabbit, Target Name: PORCN, Sample Tissue: Human Hela, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: PORCN, Sample Tissue: Human Lung Tumor, Antibody dilution: 1 ug/ml.
Host: Rabbit, Target Name: PORCN, Sample Type: Hela Whole cell, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5 ug/ml, Lysate Quantity: 25 ug/lane, Gel Concentration: 0.12%.
Host: Rabbit, Target: PORCN, Positive control (+): Human lung (LU), Negative control (-): Human liver (LI), Antibody concentration: 1 ug/ml.
Immunohistochemistry, Sample type: Mouse Uterus, - primary antibody dilution 1 in 300, - secondary antibody dilution 1 in 1000.
WB Suggested Anti-PORCN Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate.
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating