You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1215718 |
---|---|
Category | Proteins |
Description | The Swine TNF alpha Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine TNF alpha Biotinylated applications are for cell culture. Swine TNF alpha Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Swine TNF alpha Biotinylated Specifications: (Molecular Weight: 16.9 kDa) (Amino Acid Sequence: SSSQTSDKPVAHVVANVKAEGQLQWQSGYANALLANGVKLKDNQLVVPTDGLYLIYSQVLFRGQGCPSTNVFLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKDDRLSAEINLPDYLDFAESGQVYFGIIAL) (Gene ID: 397086). |
Form/Appearance | Lyophilized |
Purity | 98% |
MW | 16.9 kDa |
Target | TNF alpha |
Entrez | 397086 |
Protein Sequence | SSSQTSDKPVAHVVANVKAEGQLQWQSGYANALLANGVKLKDNQLVVPTDGLYLIYSQVLFRGQGCPSTNVFLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKDDRLSAEINLPDYLDFAESGQVYFGIIAL |
Protein Length | 154 |
Source | Yeast |
Storage | -20°C |
Alternative names | TNFSF2 Read more... |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
ELISA, WB | |
Greater than 95% by SDS-PAGE gel analyses | |
17.2 KDa | |
E.Coli |
Filter by Rating