You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1215752 |
---|---|
Category | Proteins |
Description | The Swine IFN alpha 1 Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine IFN alpha 1 Biotinylated applications are for cell culture. Swine IFN alpha 1 Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Swine IFN alpha 1 Biotinylated Specifications: (Molecular Weight: 19.0 kDa) (Amino Acid Sequence: CDLPQTHSLAHTRALRLLAQMRRISPFSCLDHRRDFGSPHEAFGGNQVQKAQAMALVHEMLQQTFQLFSTEGSAAAWNESLLHQFCTGLDQQLRDLEACVMQGAGLEGTPLLEEDSILAVRKYFHRLTLYLQEKSYSPCAWEIVRAEVMRSFSSSRNLQDRLRKKE (166)) (Gene ID: 397686). |
Form/Appearance | Lyophilized |
Purity | 98% |
MW | 19.0 kDa |
Target | IFN alpha |
Entrez | 397686 |
Protein Sequence | CDLPQTHSLAHTRALRLLAQMRRISPFSCLDHRRDFGSPHEAFGGNQVQKAQAMALVHEMLQQTFQLFSTEGSAAAWNESLLHQFCTGLDQQLRDLEACVMQGAGLEGTPLLEEDSILAVRKYFHRLTLYLQEKSYSPCAWEIVRAEVMRSFSSSRNLQDRLRKKE (166) |
Protein Length | 121 |
Source | Yeast |
Storage | -20°C |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
Filter by Rating