Porcine CXCL9 protein

• Catalog Number: orb1216281
• Category: Proteins
• Description: The Swine CXCL9 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine CXCL9 applications are for cell culture, ELISA standard, and Western Blot Control. The Swine CXCL9 yeast-derived recombinant protein can be purchased in multiple sizes. Swine CXCL9 Specifications: (Molecular Weight: 12.1 kDa) (Amino Acid Sequence: TLLMRNGRCSCINTSQRMIHLKSLRDLKQFAPSPSCEKMEVIATMKNGDQTCLNPDSPDVKKLIKEWEKQVSLKKKQKKGKKHPKTKKVRKVKKSQRPDQKKMT (104)) (Gene ID: 100135681).
• Form/Appearance: Lyophilized
• Purity: 98%
• MW: 12.1 kDa
• Target: CXCL9
• Entrez: 100135681
• Protein Sequence: TLLMRNGRCSCINTSQRMIHLKSLRDLKQFAPSPSCEKMEVIATMKNGDQTCLNPDSPDVKKLIKEWEKQVSLKKKQKKGKKHPKTKKVRKVKKSQRPDQKKMT (104)
• Protein Length: 104
• Source: Yeast
• Storage: -20°C
• Alternative names: MIG
• Note: For research use only
• Expiration Date: 6 months from date of receipt.