You have no items in your shopping cart.
Cart summary
Porcine CCL5 protein
Catalog Number: orb1216358
| Catalog Number | orb1216358 |
|---|---|
| Category | Proteins |
| Description | The Swine CCL5 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine CCL5 applications are for cell culture, ELISA standard, and Western Blot Control. The Swine CCL5 yeast-derived recombinant protein can be purchased in multiple sizes. Swine CCL5 Specifications: (Molecular Weight: 7.9 kDa) (Amino Acid Sequence: SPYASDTTPCCFSYLSRPLPRAHLQEYFYTSSKCSMAAVVFITRKNRQVCANPEKKWVREYINTLEMS) (Gene ID: 396613). |
| Form/Appearance | Lyophilized |
| Purity | 98% |
| MW | 7.9 kDa |
| Target | CCL5 |
| Entrez | 396613 |
| Protein Sequence | SPYASDTTPCCFSYLSRPLPRAHLQEYFYTSSKCSMAAVVFITRKNRQVCANPEKKWVREYINTLEMS |
| Protein Length | 68 |
| Source | Yeast |
| Storage | -20°C |
| Alternative names | RANTES Read more... |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
- Item 1 of 1
Porcine Regulated On Activation In Normal T-Cell Expressed And Secreted (RANTES) ELISA Kit [orb1203535]
Porcine
3.12-200ng/mL
1.15ng/mL
48 Test, 96 Test
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
