PLPPR3 antibody

• Catalog Number: orb580909
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PLPPR3
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Canine, Equine, Guinea pig, Mouse, Porcine, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human LPPR3
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 35kDa
• Target: PLPPR3
• UniProt ID: Q6T4P5
• Protein Sequence: Synthetic peptide located within the following region: APGPKAAETASSSSASSDSSQYRSPSDRDSASIVTIDAHAPHHPVVHLSA
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: LPR3, PRG2, LPPR3, PRG-2
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: LPPR3, Sample Type: Hela Whole Cell lysates, Antibody dilution: 1.0 ug/ml.