PLD2 antibody

• Catalog Number: orb574485
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PLD2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Equine, Human, Porcine, Rat
• Reactivity: Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PLD2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 106 kDa
• Target: PLD2
• UniProt ID: O14939
• Protein Sequence: Synthetic peptide located within the following region: DLHYRLTDLGDSSESAASQPPTPRPDSPATPDLSHNQFFWLGKDYSNLIT
• NCBI: NP_002654
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: PLD1C
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Mouse tissue extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Recommended dilution for this antibody is 1-3 ug/ml.

Lanes: Lane 1: 22 ug mouse liver cell lysate, Lane 2: 22 ug mouse liver cell lysate, Lane 3: 22 ug mouse liver cell lysate, Lane 4: 22 ug mouse liver cell lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody dilution: 1:5000, Gene Name: PLD2.

WB Suggested Anti-PLD2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Transfected 293T.