Plant Pectate lyase 1 protein

• Catalog Number: orb418831
• Category: Proteins
• Description: Recombinant Cupressus arizonica Pectate lyase 1
• Tag: N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged
• Form/Appearance: Liquid or Lyophilized powder
• Purity: Greater than 90% as determined by SDS-PAGE.
• MW: 65.1 kDa
• UniProt ID: Q9SCG9
• Protein Sequence: DNPIDSCWRGDSNWDQNRMKLADCVVGFGSSTMGGKGGEIYTVTSSEDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGADVHLGNGGPCLFMRKASHVILHGLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFTAPNESYKKEVTKRIGCETTSACANWVWRSTRDAFTNGAYFVSSGKAEDTNIYNSNEAFKVENGNAAPQLTQNAGVVA
• Protein Length: Full Length of Mature Protein
• Source: E.coli
• Biological Origin: Hesperocyparis arizonica (Arizona cypress) (Cupressus arizonica)
• Expression Region: 22-367aa
• Endotoxins: Not test.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Alternative names: Major pollen allergen Cup a 1 Allergen, Cup a 1
• Note: For research use only
• Application notes: Tag Info: N-terminal 10xHis-GST-tagged and C-terminal Myc-taggedExpression Region: 22-367aaSequence Info: Full Length
• Expiration Date: 6 months from date of receipt.