You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb578056 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to PLA2G5 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Mouse, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human PLA2G5 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 14kDa |
Target | PLA2G5 |
UniProt ID | P39877 |
Protein Sequence | Synthetic peptide located within the following region: MKGLLPLAWFLACSVPAVQGGLLDLKSMIEKVTGKNALTNYGFYGCYCGW |
NCBI | NP_000920 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | FRFB, GV-PLA2, PLA2-10, hVPLA(2) Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Rabbit Anti-PLA2G5 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Heart, Primary antibody Concentration: 10 ug/ml.
WB Suggested Anti-PLA2G5 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Thymus.
Filter by Rating