You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb587941 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to PKLR |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Human |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human PKLR |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 63kDa |
Target | PKLR |
UniProt ID | P30613 |
Protein Sequence | Synthetic peptide located within the following region: TVDPAFRTRGNANTVWVDYPNIVRVVPVGGRIYIDDGLISLVVQKIGPEG |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | PK1, PKL, RPK, PKRL Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: PKLR, Sample Type: NCI-H226 Whole Cell lysates, Antibody Dilution: 1.0 ug/ml.
Rabbit Anti-PKLR Antibody, Catalog Number: orb587941, Formalin Fixed Paraffin Embedded Tissue: Human Adult liver, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec, Protocol located in Reviews and Data.
WB Suggested Anti-PKLR antibody Titration: 1 ug/ml, Sample Type: Human liver.
Filter by Rating