You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb329700 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to PITX3 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep |
Reactivity | Canine, Equine, Guinea pig, Human, Mouse, Rat, Sheep |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PITX3 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 32kDa |
Target | PITX3 |
UniProt ID | O75364 |
Protein Sequence | Synthetic peptide located within the following region: YEEVYPGYSYGNWPPKALAPPLAAKTFPFAFNSVNVGPLASQPVFSPPSS |
NCBI | NP_005020 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti CTPP4 antibody, anti MGC12766 antibody, anti Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of human Fetal Liver tissue using PITX3 antibody
Western blot analysis of human Liver tissue using PITX3 antibody
Host: Rabbit, Target Name: PITX3, Sample Tissue: Human RPMI 8226 Whole Cell, Antibody Dilution: 1 ug/mL.
Host: Rabbit, Target Name: PITX3, Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL.
WB Suggested Anti-PITX3 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Human Liver.
IHC, WB | |
Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish | |
Canine, Equine, Guinea pig, Human, Mouse, Rat, Sheep, Zebrafish | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Animal, Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep | |
Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat, Sheep | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating