You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb575561 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to PITX2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Mouse, Porcine, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human PITX2 |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 36kDa |
Target | PITX2 |
UniProt ID | Q99697 |
Protein Sequence | Synthetic peptide located within the following region: SAVSSSSCHHPQPLAMASVLAPGQPRSLDSSKHRLEVHTISDTSSPEAAE |
NCBI | NP_000316 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | RS, RGS, ARP1, Brx1, IDG2, IGDS, IHG2, PTX2, RIEG, Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: PITX2, Sample Tissue: Human MCF7, Antibody dilution: 1.0 ug/ml.
Human Intestine
WB Suggested Anti-PITX2 Antibody Titration: 2.5 ug/ml, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate.
IF, WB | |
Gallus, Mouse, Rat, Xenopus, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating