You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb574201 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to PITX2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Equine |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human PITX2 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 35kDa |
Target | PITX2 |
UniProt ID | Q99697 |
Protein Sequence | Synthetic peptide located within the following region: EFTDSPESRKEAASSKFFPRQHPGANEKDKSQQGKNEDVGAEDPSKKKRQ |
NCBI | NP_700475 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | RS, RGS, ARP1, Brx1, IDG2, IGDS, IHG2, PTX2, RIEG, Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Mouse, Target Name: PITX2, Sample Tissue: Mouse Brain, Antibody dilution: 1 ug/ml.
WB Suggested Anti-PITX2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:31250, Positive Control: Human heart.
IHC, WB | |
Bovine, Canine, Mouse, Porcine, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, WB | |
Gallus, Mouse, Rat, Xenopus, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating