You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb324488 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to PIR |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Guinea pig, Mouse, Porcine, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human PIR |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 32kDa |
Target | PIR |
UniProt ID | O00625 |
Protein Sequence | Synthetic peptide located within the following region: SHFVLIAGEPLREPVIQHGPFVMNTNEEISQAILDFRNAKNGFERAKTWK |
NCBI | NP_003653 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of HepG2 cell lysate tissue using PIR antibody
Immunohistochemical staining of human Lung tissue using PIR antibody
Host: Rabbit, Target: PIR, Positive control (+): Human Liver (LI), Negative control (-): 293T Cell Lysate (2T), Antibody concentration: 5 ug/mL.
Human Lung
WB Suggested Anti-PIR Antibody Titration: 1.25 ug/mL, Positive Control: HepG2 cell lysate.
Filter by Rating