PIR Rabbit Polyclonal Antibody

• Catalog Number: orb324488
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PIR
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Guinea pig, Mouse, Porcine, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PIR
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 32kDa
• Target: PIR
• UniProt ID: O00625
• Protein Sequence: Synthetic peptide located within the following region: SHFVLIAGEPLREPVIQHGPFVMNTNEEISQAILDFRNAKNGFERAKTWK
• NCBI: NP_003653
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Positive control (+): Human Liver (LI), Negative control (-): 293T Cell Lysate (2T), Antibody concentration: 5 ug/mL.

Human Lung

WB Suggested Anti-PIR Antibody Titration: 1.25 ug/mL, Positive Control: HepG2 cell lysate.