Pias2 antibody

• Catalog Number: orb329894
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Pias2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Rabbit
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of mouse Pias2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 54kDa
• Target: Pias2
• UniProt ID: Q8C5D8
• Protein Sequence: Synthetic peptide located within the following region: LSLIPVDPQYCPPMFLDSLTSPLTASSTSVTTTSPHESSTHVSSSSSRSE
• NCBI: AAB96678
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti 6330408K17Rik antibody, anti AI462206 antibod
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Mouse Pancreas

WB Suggested Anti-Pias2 Antibody Titration: 0.2-1 ug/mL, Positive Control: NIH/3T3 cell lysate.

WB Suggested Anti-Pias2 antibody Titration: 1 ug/mL, Sample Type: Human heart.