You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb577036 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to PHF21A |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Canine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human PHF21A |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 70kDa |
Target | PHF21A |
UniProt ID | Q96BD5 |
Protein Sequence | Synthetic peptide located within the following region: MELQTLQEALKVEIQVHQKLVAQMKQDPQNADLKKQLHELQAKITALSEK |
NCBI | NP_057705 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | BHC80, NEDMS, BM-006, IDDBCS Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: PHF21A, Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: PHF21A, Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: PHF21A, Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.
WB Suggested Anti-PHF21A Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: HT1080 cell lysate. PHF21A is supported by BioGPS gene expression data to be expressed in HT1080.
ELISA, FC, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating