You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb331031 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to PGP9.5 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Zebrafish |
Reactivity | Human, Mouse, Rat |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human UCHL1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 25kDa |
Target | UCHL1 |
UniProt ID | P09936 |
Protein Sequence | Synthetic peptide located within the following region: ELDGRMPFPVNHGASSEDTLLKDAAKVCREFTEREQGEVRFSAVALCKAA |
NCBI | NP_004172 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti-Epididymis luminal protein 117 antibody, anti Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Type: 1. Rat brain cells (100 ug), 2. Rat Brain cells (100 ug) incubatde with HA-UbVME, Band a: unmodified HA-UbVME, Band b: modified UCHL1, Primary dilution: 1:1000, Secondary Antibody: alkaline phosphatase-conjugated anti-rabbit, Secondary dilution: 1:1000.
Sample Tissue: Mouse Skeletal Muscle, Antibody dilution: 1 ug/ml.
Lanes: Lane 1: 75000 rat INS cells, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti rabbit-HRP, Secondary Antibody dilution: 1:1000, Gene Name: UCHL1.
WB Suggested Anti-UCHL1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Muscle.
ELISA, ICC, IF, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FACS, IF, IHC-P, WB | |
Human, Rat | |
Mouse | |
Recombinant | |
Unconjugated |
FC, ICC, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Zebrafish | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-P, WB | |
Equine, Mouse, Porcine | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating