PFN1 antibody

• Catalog Number: orb580352
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PFN1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Equine, Guinea pig, Rat, Zebrafish
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PFN1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 15 kDa
• Target: PFN1
• UniProt ID: P07737
• Protein Sequence: Synthetic peptide located within the following region: AGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVL
• NCBI: NP_005013
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: ALS18
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 10-20% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Canonical 15 kDa isoform is identified, and a second isoform of 18 kDa is also present in some samples.

Lanes: 1. 20 ug human pregnant uterine muscle cells + hormone, 2. 20 ug human pregnant uterine muscle cells - hormone, Primary Antibody dilution: 1:2000, Secondary Antibody: Goat anti-rabbit-Alexa Fluor 680, Secondary Antibody dilution: 1:25000, Gene Name: PFN1.

Lanes: 1. 20 ug murine non-pregnant uteria tissue, 2. 20 ug murine non-laboring uterine tissue, 3. 20 ug murine laboring uterine tissue, 4. 20 ug murine preterm laboring uterine tissue, Primary Antibody dilution: 1:2000, Secondary Antibody: Goat anti-rabbit-Alexa Fluor 680, Secondary Antibody dilution: 1:25000, Gene Name: PFN1.

Rabbit Anti-PFN1 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Liver, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

Rabbit Anti-PFN1 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Spleen, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

Rabbit Anti-PFN1 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Tonsil, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-PFN1 Antibody Titration: 0.2-1 ug/ml, Positive Control: Human Liver.