PFKFB3 monoclonal antibody (M08), clone 3F3

• Catalog Number: orb2292421
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant PFKFB3.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3F3
• Tested applications: ELISA, IP, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: PFKFB3 (NP_004557, 412 a.a. ~ 520 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: CPLHTVLKLTPVAYGCRVESIYLNVESVCTHRERSEDAKKGPNPLMRRNSVTPLASPEPTKKPRINSFEEHVASTSAALPSCLPPEVPTQLPGQNMKGSRSSADSSRKH
• NCBI: NP_004557
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged PFKFB3 is approximately 3 ng/ml as a capture antibody.

Immunoprecipitation of PFKFB3 transfected lysate using anti-PFKFB3 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PFKFB3 MaxPab rabbit polyclonal antibody.

Western Blot analysis of PFKFB3 expression in transfected 293T cell line by PFKFB3 monoclonal antibody (M08), clone 3F3. Lane 1: PFKFB3 transfected lysate (59.6 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (37.73 KDa).