Cart summary

You have no items in your shopping cart.

    Peptide YY/PYY Antibody

    Catalog Number: orb371748

    DispatchUsually dispatched within 5-10 working days
    $ 520.00
    Catalog Numberorb371748
    CategoryAntibodies
    DescriptionPeptide YY/PYY Antibody
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsIF, IHC, WB
    ReactivityMouse, Rat
    IsotypeRabbit IgG
    ImmunogenA synthetic peptide corresponding to a sequence in the middle region of mouse Peptide YY (29-64aa YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY), different from the related human sequence by three amino acids, and identical to the related rat sequence.
    ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
    Form/AppearanceLyophilized
    ConjugationUnconjugated
    MW11064 MW
    UniProt IDQ9EPS2
    StorageStore at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
    Alternative namesPeptide YY ;PYY ;Peptide tyrosine tyrosine;Peptide
    Read more...
    NoteFor research use only
    Application notesTested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
    Expiration Date12 months from date of receipt.
    Peptide YY/PYY Antibody

    WB analysis of Peptide YY using anti-Peptide YY antibody.Lane 1:mouse spleen tissue;2:mouse liver tissue.

    Peptide YY/PYY Antibody

    IF analysis of Peptide YY using anti-Peptide YY antibody. Peptide YY was detected in a paraffin-embedded section of rat stomach tissue.

    Peptide YY/PYY Antibody

    IHC analysis of Peptide YY using anti-Peptide YY antibody.Peptide YY was detected in paraffin-embedded section of mouse intestine tissues.

    Peptide YY/PYY Antibody

    IHC analysis of Peptide YY using anti-Peptide YY antibody.Peptide YY was detected in paraffin-embedded section of mouse intestine tissues.

    Peptide YY/PYY Antibody

    IHC analysis of Peptide YY using anti-Peptide YY antibody.Peptide YY was detected in paraffin-embedded section of mouse pancreas tissues.

    Peptide YY/PYY Antibody

    IHC analysis of Peptide YY using anti-Peptide YY antibody.Peptide YY was detected in paraffin-embedded section of rat intestine tissues.

    Peptide YY/PYY Antibody

    IHC analysis of Peptide YY using anti-Peptide YY antibody.Peptide YY was detected in paraffin-embedded section of rat pancreas tissues.

    • PYY Antibody [orb1264317]

      FC,  IF,  IHC-P,  WB

      Human

      Rabbit

      Polyclonal

      Unconjugated

      400 μl
    • Peptide YY/PYY Antibody [orb527005]

      IHC

      Human

      Rabbit

      Polyclonal

      Unconjugated

      10 μg, 100 μg
    • Peptide YY antibody [orb6827]

      ELISA,  IF,  IHC-Fr,  IHC-P

      Human

      Rabbit

      Polyclonal

      Unconjugated

      200 μl, 100 μl, 50 μl
    • Rat PYY ELISA Kit [orb779827]

      Rat

      15.63-1000 pg/mL

      4.71 pg/mL

      96 Test, 48 Test, 24 t
    • Mouse PYY ELISA Kit [orb777223]

      Mouse

      15.63-1000 pg/mL

      4.52 pg/mL

      48 Test, 96 Test, 24 t
    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars