Peptide YY (3-36) (human)

• Catalog Number: orb1147055
• Category: Proteins
• Description: Neuropeptide Y2 receptor agonist; Peptides.
• CAS Number: 126339-09-1
• Modifications: C terminal amide.
• Structure: H-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2
• Target Areas: Neuropeptide Y receptors
• Form/Appearance: Freeze dried solid
• Purity: > 95% by HPLC
• MW: 4049.6 Da
• Formula: C₁₈₀H₂₇₉N₅₃O₅₄
• Solubility (25°C): Soluble in dilute acid
• Protein Sequence: H-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2
• Storage: Store dry, dark and frozen
• Alternative names: IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2, 126339-09-
• Background: PYY (3-36) is the N-terminal truncated metabolite of PYY1-36 and is released from the gastrointestinal tract postprandially in proportion to the calorie content of a meal. PYY(3-36) reduces appetite and inhibits food intake through action as a Y2 receptor agonist with IC50 values of 0.11 and 1050 nM for inhibition of 125I-PYY binding to Y2 and Y1 receptors respectively. Peptide YY (3-36) can inhibit food intake and reduce weight gain in vivo.
• Note: For research use only
• Expiration Date: 12 months from date of receipt.