Pepd antibody

• Catalog Number: orb582993
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Pepd
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Human, Rabbit, Rat, Zebrafish
• Reactivity: Mouse
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 54kDa
• Target: Pepd
• UniProt ID: Q11136
• Protein Sequence: Synthetic peptide located within the following region: YSRGGMRHTSYTCICCSGENAAVLHYGHAGAPNDRTIKDGDICLFDMGGE
• NCBI: NP_032846
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: d, Pe, Pep, dal, Pep4, Pep-4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-Pepd Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse Small Intestine.