You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb584166 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to PEA15 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human PEA15 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 15kDa |
Target | PEA15 |
UniProt ID | Q5U318 |
Protein Sequence | Synthetic peptide located within the following region: DYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKLAPPPKKA |
NCBI | NP_003759 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | PED, MAT1, HMAT1, MAT1H, PEA-15, HUMMAT1H, PED-PEA Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Rabbit Anti-PEA15 Antibody, Catalog Number: orb584166, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-PEA15 Antibody, Positive Control: Lane 1: 20 ug EGFP-transfected MCF7 lysate, Lane 2: 20 ug EGFP-PEA15 transfected MCF7 lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Goat anti-rabbit-HRP, Secondry Antibody dilution: 1:5000.
WB Suggested Anti-PEA15 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Human brain.
IHC, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
FC, IHC-P, WB | |
Hamster, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IH, WB | |
Human, Mouse, Primate, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating