PDZRN3 antibody

• Catalog Number: orb325057
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PDZRN3
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Guinea pig, Mouse, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human PDZRN3
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 80kDa
• Target: PDZRN3
• UniProt ID: Q9UPQ7
• Protein Sequence: Synthetic peptide located within the following region: ELDRFDGDVDPDLKCALCHKVLEDPLTTPCGHVFCAGCVLPWVVQEGSCP
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: LNX3, SEMCAP3, SEMACAP3
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: PDZRN3, Sample Type: Fetal Thymus lysates, Antibody Dilution: 1.0 ug/mL.

Host: Rabbit, Target: PDZRN3, Positive control (+): 293T (2T), Negative control (-): A549 (N03), Antibody concentration: 1 ug/mL.