You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb325057 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to PDZRN3 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Guinea pig, Mouse, Rat, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human PDZRN3 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 80kDa |
Target | PDZRN3 |
UniProt ID | Q9UPQ7 |
Protein Sequence | Synthetic peptide located within the following region: ELDRFDGDVDPDLKCALCHKVLEDPLTTPCGHVFCAGCVLPWVVQEGSCP |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | LNX3, SEMCAP3, SEMACAP3 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: PDZRN3, Sample Type: Fetal Thymus lysates, Antibody Dilution: 1.0 ug/mL.
Host: Rabbit, Target: PDZRN3, Positive control (+): 293T (2T), Negative control (-): A549 (N03), Antibody concentration: 1 ug/mL.
WB | |
Bovine, Equine, Guinea pig, Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating