You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330388 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to PDPN |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Human |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human PDPN |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 24 kDa |
Target | PDPN |
UniProt ID | Q86YL7 |
Protein Sequence | Synthetic peptide located within the following region: EGASTGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRYKSGLTTLVAT |
NCBI | NP_006465 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti GP36 antibody, anti GP40 antibody, anti Gp38 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 10-20% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. Peptide is present in multiple protein isoforms, including the canonical 17 kDa protein, as well as a 24 kDa protein and the protein may be heavily glycosylated.
Human Lung
WB Suggested Anti-PDPN Antibody Titration: 0.2-1 ug/mL, Positive Control: Jurkat cell lysate.
ELISA, FC, ICC, IF, IHC, WB | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC-P | |
Human | |
Mouse | |
Monoclonal | |
Unconjugated |
Filter by Rating