PDPN antibody

• Catalog Number: orb330388
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PDPN
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Human
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PDPN
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 24 kDa
• Target: PDPN
• UniProt ID: Q86YL7
• Protein Sequence: Synthetic peptide located within the following region: EGASTGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRYKSGLTTLVAT
• NCBI: NP_006465
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti GP36 antibody, anti GP40 antibody, anti Gp38
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 10-20% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. Peptide is present in multiple protein isoforms, including the canonical 17 kDa protein, as well as a 24 kDa protein and the protein may be heavily glycosylated.

Human Lung

WB Suggested Anti-PDPN Antibody Titration: 0.2-1 ug/mL, Positive Control: Jurkat cell lysate.