You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb316598 |
---|---|
Category | Antibodies |
Description | PDPK1 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Hamster |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human PDPK1 (524-556aa YLMDPSGNAHKWCRKIQEVWRQRYQSHPDAAVQ), different from the related mouse and rat sequences by two amino acids. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 63152 MW |
UniProt ID | O15530 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | 3-phosphoinositide-dependent protein kinase 1;hPDK Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
WB analysis of PDPK1 using anti-PDPK1 antibody.Lane 1:Rat Liver Tissue;2:Rat Lung Tissue;3:Mouse Liver Tissue;4:Mouse Lung Tissue;5:COLO320 Cell;6:MCF-7 Cell.
IHC analysis of PDPK1 using anti-PDPK1 antibody.PDPK1 was detected in paraffin-embedded section of Mouse Intestine Tissue.
IHC analysis of PDPK1 using anti-PDPK1 antibody.PDPK1 was detected in paraffin-embedded section of Rat Testis Tissue.
IHC analysis of PDPK1 using anti-PDPK1 antibody.PDPK1 was detected in paraffin-embedded section of Human Lung Cancer Tissue.
IHC analysis of PDPK1 using anti-PDPK1 antibody.PDPK1 was detected in frozen section of mouse small intestine tissue.
IHC analysis of PDPK1 using anti-PDPK1 antibody.PDPK1 was detected in frozen section of human placenta tissue.
ELISA, FC, ICC, IHC, WB | |
Human, Monkey, Mouse, Rat | |
Mouse | |
Monoclonal | |
Unconjugated |
ELISA, IF, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating