You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb576835 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to PDLIM5 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human PDLIM5 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 64kDa |
Target | PDLIM5 |
UniProt ID | Q96HC4 |
Protein Sequence | Synthetic peptide located within the following region: SNYSVSLVGPAPWGFRLQGGKDFNMPLTISSLKDGGKAAQANVRIGDVVL |
NCBI | NP_006448 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | L9, ENH, LIM, ENH1 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: PDLIM5, Sample Type: HepG2, Antibody Dilution: 1.0 ug/ml. There is BioGPS gene expression data showing that PDLIM5 is expressed in HepG2.
Host: Rabbit, Target Name: PDLIM5, Sample Type: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5.0 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 12%. There is BioGPS gene expression data showing that PDLIM5 is expressed in HepG2.
Host: Rabbit, Target Name: PDLIM5, Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: PDLIM5, Sample Type: Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: PDLIM5, Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: PDLIM5, Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: PDLIM5, Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.
WB Suggested Anti-PDLIM5 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate. There is BioGPS gene expression data showing that PDLIM5 is expressed in HepG2.
Filter by Rating