PDK1 Rabbit Polyclonal Antibody

• Catalog Number: orb329620
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PDK1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Yeast
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PDK1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 47kDa
• Target: PDK1
• UniProt ID: Q15118
• Protein Sequence: Synthetic peptide located within the following region: ATMEHHANRGVYPPIQVHVTLGNEDLTVKMSDRGGGVPLRKIDRLFNYMY
• NCBI: NP_002601
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Mouse Testis, Antibody Dilution: 1 ug/mL.

Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/mL.

Sample Tissue: Mouse Testis, Antibody Dilution: 1 ug/mL.

Sample Type: Human Jurkat, Antibody Dilution: 1.0 ug/mL, PDK1 is supported by BioGPS gene expression data to be expressed in Jurkat.

WB Suggested Anti-PDK1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: MCF7 cell lysate.