You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb581571 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to PDIA6 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PDIA6 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 48kDa |
Target | PDIA6 |
UniProt ID | Q15084 |
Protein Sequence | Synthetic peptide located within the following region: KLAAVDATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIVSRA |
NCBI | NP_005733 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | P5, ERP5, TXNDC7 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: PDIA6, Sample Type: 721_B, Antibody dilution: 1.0 ug/ml. PDIA6 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.
Host: Rabbit, Target Name: PDIA6, Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: PDIA6, Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: PDIA6, Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: PDIA6, Sample Type: MCF7, Antibody dilution: 1.0 ug/ml. PDIA6 is strongly supported by BioGPS gene expression data to be expressed in MCF7.
Immunohistochemistry with Small intestine tissue.
WB Suggested Anti-PDIA6 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: HepG2 cell lysate. PDIA6 is strongly supported by BioGPS gene expression data to be expressed in HepG2.
FC, ICC, IF, IHC, WB | |
Human, Monkey | |
Mouse | |
Monoclonal | |
Unconjugated |
ELISA, FC, ICC, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, IP, WB | |
Bovine, Canine, Equine, Porcine, Rabbit, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating