PDIA6 antibody

• Catalog Number: orb581570
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PDIA6
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, IP, WB
• Predicted Reactivity: Bovine, Canine, Equine, Porcine, Rabbit, Rat
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PDIA6
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 48kDa
• Target: PDIA6
• UniProt ID: Q922R8
• Protein Sequence: Synthetic peptide located within the following region: KNRPEDYQGGRTGEAIVDAALSALRQLVKDRLGGRSGGYSSGKQGRSDSS
• NCBI: NP_005733
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: P5, ERP5, TXNDC7
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: 2. mouse brain extracts (80 ug), Primary Antibody dilution: 2 ug/ml, Secondary Antibody: IRDye 800CW goat anti-rabbit, Secondary Antibody dilution: 1:20000.

Sample Type: NT2 cells, Red: Antibody, Blue: DAPI, Primary dilution: 1 ug/50 ul antibody, Secondary Antibody: Alexa goat anti-rabbit 594.

Amount and Sample Type: 500 ug Human NT2 cell lysate, Amount of IP Antibody: 6 ug, Primary Antibody: PDIA6, Primary Antibody dilution: 1:500, Secondary Antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary Antibody dilution: 1:5000, Gene Name: PDIA6.

Host: Rabbit, Target Name: PDIA6, Sample Tissue: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

Sample Type:Mouse Brain lysate.

WB Suggested Anti-PDIA6 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: 721_B cell lysate. PDIA6 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.