You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb581570 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to PDIA6 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, IP, WB |
Predicted Reactivity | Bovine, Canine, Equine, Porcine, Rabbit, Rat |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human PDIA6 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 48kDa |
Target | PDIA6 |
UniProt ID | Q922R8 |
Protein Sequence | Synthetic peptide located within the following region: KNRPEDYQGGRTGEAIVDAALSALRQLVKDRLGGRSGGYSSGKQGRSDSS |
NCBI | NP_005733 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | P5, ERP5, TXNDC7 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Type: 2. mouse brain extracts (80 ug), Primary Antibody dilution: 2 ug/ml, Secondary Antibody: IRDye 800CW goat anti-rabbit, Secondary Antibody dilution: 1:20000.
Sample Type: NT2 cells, Red: Antibody, Blue: DAPI, Primary dilution: 1 ug/50 ul antibody, Secondary Antibody: Alexa goat anti-rabbit 594.
Amount and Sample Type: 500 ug Human NT2 cell lysate, Amount of IP Antibody: 6 ug, Primary Antibody: PDIA6, Primary Antibody dilution: 1:500, Secondary Antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary Antibody dilution: 1:5000, Gene Name: PDIA6.
Host: Rabbit, Target Name: PDIA6, Sample Tissue: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.
Sample Type:Mouse Brain lysate.
WB Suggested Anti-PDIA6 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: 721_B cell lysate. PDIA6 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.
FC, ICC, IF, IHC, WB | |
Human, Monkey | |
Mouse | |
Monoclonal | |
Unconjugated |
ELISA, FC, ICC, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating