You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb585694 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to PDIA3 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, IP, WB |
Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish |
Reactivity | Human |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 56kDa |
Target | PDIA3 |
UniProt ID | P30101 |
Protein Sequence | Synthetic peptide located within the following region: YFSPANKKLNPKKYEGGRELSDFISYLQREATNPPVIQEEKPKKKKKAQE |
NCBI | NP_005304 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | P58, ER60, ERp57, ERp60, ERp61, GRP57, GRP58, PI-P Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Amount and Sample Type: 500 ug Human NT2 cell lysate, Amount of IP Antibody: 6 ug, Primary Antibody: PDIA3, Primary Antibody dilution: 1:500, Secondary Antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary Antibody dilution: 1:5000, Gene Name: PDIA3.
Host: Rabbit, Target Name: PDIA3, Sample Type: Human 721_B, Antibody dilution: 1.0 ug/ml. PDIA3 is supported by BioGPS gene expression data to be expressed in 721_B.
Host: Rabbit, Target Name: PDIA3, Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: PDIA3, Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.
IP Suggested Anti-PDIA3 Antibody Positive Control: NT2 CELL/BRAIN TISSUE.
PDIA3 antibody - C-terminal region (orb585694) validated by WB using Fetal Kidney Lysate at 1.0 ug/ml.
Sample Type: NT2 cells, Red: Antibody, Blue: DAPI, Primary dilution: 1 ug/50 ul antibody, Secondary Antibody: Alexa goat anti-rabbit 594.
Sample Type: Human brain stem cells, Primary Antibody dilution: 1:500, Secondary Antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary Antibody dilution: 1:1000, Color/Signal Descriptions: PDIA3: Red DAPI:Blue, Gene Name: PDIA3.
FC, ICC, IF, IHC, IHC-Fr, WB | |
Bovine | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating